SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN07759 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN07759
Domain Number - Region: 383-419
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000227
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN07759
Sequence length 866
Comment (Caenorhabditis brenneri)
Sequence
MPDDDTSPNPSPNLQPVSPTSPEPVVLATDACIGLLRTSKITADTITTVRNAVAEDLRFV
HTRITDVSDAASGRFERAEQRLAILEGKFESLKVASPQVLVATDSQLTLTPTITNSGIPQ
TNDPLATPLASTIRRSHVPPPLNLSTENPDNTVTVEEPSTPRPTSLNLSEPPGAPIRPST
TRKSESFYVNVMSMKMPLNIPTFSGASHENFSTFIRSFMDHANAAKSQLTPESKLSVFLT
YLTDFARDKAQELMDTKQEASFDDVVAYLKSTFQDPTRAETERQQLRQCTQRPDESVDAF
STRVRKLAQSAYVDKSRDYIADKAKEAFLDGLAFNLKFHVKGESSSTFQEAQNSAIKFEL
LLAEAAKANTIAPQGLAVVPAPQEFPHQPDQPRFKTGTVCFRCGFEGHYKNQCWRFQNEH
DQDNYQNHGPRPQYFDRTPQFPTNDPVQRYQIRGDQQQYNSRYINSLEPVQNPLVDQLRF
ELQANQAQMDALIKRNAELAAAATSAPASKRINVLAAVPRLGPLLTLFTLVTLISPSSAF
TPLISFSGTFVKETVNCFMMPTSIRARYGSEAPHSAAGPMENCKFSSGACTTREGATFIW
KPVETQQQRYIFFATMKGHKSDRIWLSENKEFFLSFDGKSHKVIDGNKKLLLTDQGCAVM
VPPRDKRHAEPEEEAANINMTSFVTSNQPPAQLTANRFAVLEKSGTRFWHDFMALCASSN
RLASATLAAAASNPPIAARKLTGKENIQAKFIKGQYTDVWEAMRGSPYVTSRRFSVHEDP
STGSITVANLEKAVSVWEKFKSFAETVFSVCSIVCDLIVMVIVGIVLIFGVAKFYIGPWL
VLVRAKSENPVPTTSEGLNRSYQPEE
Download sequence
Identical sequences G0MQQ1
CBN07759 135651.CBN07759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]