SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN08441 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN08441
Domain Number - Region: 6-87
Classification Level Classification E-value
Superfamily POZ domain 0.0408
Family BTB/POZ domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN08441
Sequence length 132
Comment (Caenorhabditis brenneri)
Sequence
MTGTSQLSIYEKAFAKSDKTDAILVVDGKKLHVKKAKNAENLLKLADRFLMSSSKLIVIN
LIKTSTEFERFEKLCLADKYKLEDLLKYTVGLYFNKECFYDFYRWSDRVKEELSHETQSK
LFQRYFFFGFGN
Download sequence
Identical sequences G0MVZ3
CBN08441 135651.CBN08441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]