SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN09057 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN09057
Domain Number 1 Region: 454-888
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.56e-124
Family Reverse transcriptase 0.000039
Further Details:      
 
Domain Number 2 Region: 1068-1223
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.9e-38
Family Retroviral integrase, catalytic domain 0.0055
Further Details:      
 
Domain Number 3 Region: 322-414
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000165
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Domain Number 4 Region: 254-295
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000855
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN09057
Sequence length 1390
Comment (Caenorhabditis brenneri)
Sequence
MASIEEQIATLTQAVATLAQLQAQQAQAQAQAPTATGAPRLFDQIANRIPQFVYDPELDK
TFDLWYVRYKDVINKDGQTLSDEEKARIILSKISDSNYTFYANRLLPKSPNDFTYTETVD
LLKKTFKSTSSVFKKRQDFLRLEYDGTNIEEYTGTVLRKFTESEFKKMSDDQICCMVWIS
GLRDGALNDMRTKALQTMESKPDITLLELESEVKRLMDIRADAKTIASPTTGINLVRKQQ
HKNPKQTVGSKYDKPPPSPCPSCKGSHWLKDCPNPKTECRKCKKLGHSEKDCRVKTWKQN
KREEASKVNSVIIRAAATPGANRIYRTLQVNGKSIRMQVDTGADVTLLSKEDWKKLGQPI
LNTPTISVKSANHQPIDVQGWFTCNVTIGNEEQNLKAHVADTETLLGTDWLARDHQLWNL
LNSSQQINSVGSPTGSACVYLDSAREQLQKSLEQEYPQVFHSGLGKCTKLKAEIRLKPDA
KPVFRKARPVPYATLAAVSDELDRLTTQGVLAPVDHSSWAAPIVIVKKKNGSIRMCADYS
TGLNDSIEQHRHPLPTAEDIFTVINGGKFFTQIDLAEAYLQIELDDQSKNLLSINTHKGI
YQFQRLPFGVKSAPGIFQQVMDQLVNGIEGVSAYLDDIIITGGTIEEHNIRLKKVMCRIN
EFGMRMKLEKCKFLMEEIRFLGFIVDKNGRRPDPEKIAAIKDMPAPKDVTQVKSFLGLIQ
FYGAFVKHLFRLRPPLDALTKKDTPFKWSRDCQHAFDKIKEALQSDLLLTHFDPTKPIIV
AADASKDGIGGVLLHQYPDGSQKAVFHISKALNKAQQNYSQIEKEGFALITAVTKFHKYL
HGRSFTLKTDHKPLLSIFGDKKGVPVYSANRLQRWATILLNYQFNIEYVNTLAFGQADAL
SRLIAENTNNLEQEDQVIAQIETDVVDTLEHGCQQLPVNARIIRQFSKKDPTLQEVYKFV
KSGHWPRSIPKETPLRDFYNRRGDLYIVHRCVMFGERIIIPTKLRNRVLRMLHRAHPGIV
RMKKLARSFVYWPSIDSEIENIVKSCDQCAAVAKDPTKNTLCSWPLTTAPWQRVHVDYAG
PLNGKYYLVMVDSYSKWPEVHMTSSISTSATVKLFQQIFSQFGVPETLVTDNGPQFTSNA
FNNFCVAQGITHVRSPPYHPQSNGQAERFVDSLKRALGKLKGEETDDAALKLFLQSYRST
PCDSSPNQASPAENFIGRRIRTFLNQLLPTADQINSDRNESMELQFNRYHGARTKEFGPT
EKVYVKDYRNLSTPTWIPGTILRRIGQTLYSVRVDGNLTWKRHANQLRPRGSSPLTDTPM
DMIDSPQNLDESQTRADSDVSSVPSPVPMTCSVPTTTTPSPAVPRRSSRATGPPSRLVMD
PTKKTYTPLH
Download sequence
Identical sequences G0NBB0
CBN09057 135651.CBN09057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]