SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN09246 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN09246
Domain Number 1 Region: 461-896
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.9e-120
Family Reverse transcriptase 0.0000388
Further Details:      
 
Domain Number 2 Region: 343-433
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000018
Family Retroviral protease (retropepsin) 0.022
Further Details:      
 
Domain Number 3 Region: 270-316
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000116
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN09246
Sequence length 1002
Comment (Caenorhabditis brenneri)
Sequence
MAEKETEKRFMDMMLMMQKQLELQSKQHEESMQALTKMFIGQGGSQGTSVDTGAAQTQLI
SSISTRISMFQFELETEKTFSKWYDRHGSIITVDGKDLTDENKVSLLIGKLSDEVFEQYT
KRICPKKFTEISFDETVKTLKEMFDIEKSLFSHRFACINIAREGDSPVEYTNKVNSLCEA
AMLKDIDPDGWKVFFWLRGLDSNADKQMRTYFIKYVEQKWEKKETVRIIDLCAEWQKMIR
QNTVSSEIEKDVSVKAVQAKNSKSVKKQPKKDDKSSEACWNCGKEGHKKPDCSQKLTKCF
NCQKTGHMSKFCKSKKANSTKRTQNVVIVEGASTEESNVNSIRQYVTAEVSEVIVEFQLD
TGSDITLIGKDDWVRMGKPELEKCPTKVKSASGNELQLLGRALVNFTLKGSEGSGYLYVR
EHGNLLGLDWIEKSEEMSYHMGMMVNALSHSTSGSIQEELQQKFPKVFEEGLGRCTKEKA
VLKVKPNSTPVFKPKRPVPYGALETVEKELDRLEGLGVLKKVNHSKWAAPLVCVKKAGGD
IRVCVDLSTGLNDALEDEDHPIPPPEDIFASMNGGRYFSTVDFKDAYLQIELAEESRHLF
TINTHRGLYEYQRLVFGAKTAPAVFQRIMDKMITGLSGVTAYLDDVIIIGRSVQEHNDNL
FEVFKRISEYGFRVKLEKCKFLEEKIKYLGFIIDRNGRRPDESKVQPIKGMCDPKNQKEL
RSFMGMITYYSAFIPQMKSLRGPLDKLLLKDVEWRWSTKEAEAFQKLKDVLSSDLNLTHY
DPQIPIVVAADACDYGIGAVISHRFPNGDEKPIAHAARSLNAAEKNYSQIEKEGLGLIFA
VKRFHKYLFGRKFLLRTDHKPLLSIFGSKKGIPVHSQNRLVRWSTILRGYDFDIEYVKTD
DFGQADALSRMIQKFPTENEDIVIAQVEVEVEETLHGAIRKLPVRVADVQEETQKSKLLQ
EVQKYVSRGVWPKKVDEKLKRFSSIKESLSCVQKCLMMQDRV
Download sequence
Identical sequences G0PM16
CBN09246 135651.CBN09246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]