SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN09505 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN09505
Domain Number - Region: 355-386
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00034
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN09505
Sequence length 546
Comment (Caenorhabditis brenneri)
Sequence
MFQVDAAVAASAAAPSTVQSSPLQVVTVGGVKGSGPLVLGTRKEALMIDPSEDLLQLDDD
SLSIANDQGMLSETELDAMVNVEKTEEVIASESPILMNQLSQWTSPTENKVSKNTVTRSF
TDVFYLLVKDFVREPSLPVEEIQHVQVQALQVQPPLREVSRGNELATMLPPEIWNSLQLL
PELVMSVDQLRKDFAASNNQEQAQFVQKQELKKLLAPLKNLDMIVPKLMNVEKLATDNLH
ATRGCAGRIDSHKEARLKDSAAQLAHMEDVSKTVKYLTGTIKSVKDYTARKTVELNKTMA
TPGANKRQGSSSTPYASYAPGLEVMAAHGEMRDIARSYHQDQQVKAKAAAAANPSYQPNK
ANRCIFCGLQGHPFMECPHYRDPLARRHVLLAQGKCWVCFDDKCDSSASNCPVTRRRLCP
KCSHMPHATRVHHESLCINPKSNQGVVSNNNAIMTAHQGFNEQVAQSNEQFQRKRTKKNN
GQSSNAAAKRSRHSSQSSQRIFVPPLRQISSDQPMATEDNENTVQIPKKKKSKKSARKNN
NNATKA
Download sequence
Identical sequences G0MCW9
135651.CBN09505 CBN09505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]