SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN10092 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN10092
Domain Number 1 Region: 445-740
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-61
Family Tandem AAA-ATPase domain 0.0000443
Further Details:      
 
Domain Number 2 Region: 155-208
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000721
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 
Domain Number 3 Region: 262-307
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000221
Family Retrovirus zinc finger-like domains 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN10092
Sequence length 786
Comment (Caenorhabditis brenneri)
Sequence
MTDTDGWDDAPAKPSGGNTGGSGFGSKSSGFGNSGASGFGGGNSGGFGGNSGGSGFGGGN
TAGSGFGGGNTGGSGFGGGNTGGSGFGGGNSGGSGFGGGKSNGFGGGSGGGFGGGGNCTS
FGGGNTGGGFGGGNSGGFGGGSSGFGGESGGYGGERGERNNNCFNCQQPGHRSADCPEPR
KPRDGGAPRNCYNCQQPGHNSRDCPEERKPRENRGGGGGFGGGSGFGGQSGGFGGGSGFG
EAGNDGGFGGGFGGESGGFGGGEERGPMKCFNCRGEGHRSSDCPEPPRGCFNCGEQGHRS
SECTNPPKPREHAEGEGPKATYVPQEDTMEDVFNMQKISEGLMFNKFFDAEVQVTSCGKN
CKVTAVRTFNEAELTETMRKNVQHAGYNKTTPIQQYAIPLIRSGHDIMACAQTGSGKTAA
FLLPIMSRLMDDNDLNTAGEGGCYPRCIILTPTRELADQIYNEGRKFSYQTMMEIKPVYG
GLAVGYNKSQIEKGATIIVGTVGRIKHFCEEGTIKLDKCRFFVLDEADRMIDAMGFGNDI
ETIVNYENMPKKEDRQTLMFSATFPDSVQEAARCFLKNNYTMITIDKIGAANKCVVQEFE
KCDRSEKKDKLLELLGIDIDSYSTEKNAEVYTKKTIVFVSQRAMADTLAAILSSAQVPAI
TIHGAREQRERSEALRHFRTGTKPVLIATAVAERGLDIKGVDHVINYDMPDNIDDYIHRI
GRTGRVGNSGRATSFISEDSPLIPDLLKVLADAEQNVPEWMQGPAAGNYGATGFGSSVQT
QDDEGW
Download sequence
Identical sequences G0MPS1
CBN10092 135651.CBN10092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]