SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN11346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN11346
Domain Number - Region: 75-100
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00157
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN11346
Sequence length 239
Comment (Caenorhabditis brenneri)
Sequence
MANANLTPMPFVRKFGSASTTTSSDRNSSPTSKDGRSSQKQSLASLAQTAFPSRYDPNAF
VDISGAAISAPTVTGACKRCGYPGHLYFQCRNHIEVRPNMSTKAYDVSSTSSESSDDETP
LALDRKKEKKLRKKERKERKKAKKLEKKEKRRKERKEKKKRRQEDSDEASDSDDERKEKA
RKEKKRRRHNDSDDESDDSDDSRKKKAKKSKKERRKRNHSSSSSEDSHNDSKRRRRSDY
Download sequence
Identical sequences G0NX93
135651.CBN11346 CBN11346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]