SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN12555 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN12555
Domain Number 1 Region: 452-856
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.67e-116
Family Reverse transcriptase 0.0000619
Further Details:      
 
Domain Number 2 Region: 1020-1176
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.39e-40
Family Retroviral integrase, catalytic domain 0.0066
Further Details:      
 
Domain Number 3 Region: 325-399
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000183
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Weak hits

Sequence:  135651.CBN12555
Domain Number - Region: 259-301
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0215
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN12555
Sequence length 1333
Comment (Caenorhabditis brenneri)
Sequence
MERDELTQQVANLVAALQAIAQNGQVSNQPPATPPTEPNNNVSRLLDSLSSRIPKFSYDP
EEDITFENWWSRYQDIVTKDGAALSEDHKTRLLLEKLDKKEYALYANNVLPKLPTEISFE
ESIKTLKLLFKSTTSVFRKRQDFLRIEYHGTGLEEYTGKVLRGFTSSEFKKMTQICIMIW
IGGLKGESYQDIRLRALQLIESKPAITLLELEGEVKKLIDIKTDAKSLSAANTKSVDVNA
IQKAKKKGENTAKADKSQKKPPSSPCFRCKGKHWSSDCEWKEAVCNYCKKIGHLEKCCIT
KKREAKQSPKVKSDMAEAAQSVGIHRIYKAVEINGKAIPTLFDTGADVTLLSPTHWKELG
APKLKKTSFQIKSANHQPIDVLGYFQCDFVLNGNVGSGPAYVADGYLTRNRMDQSGQNPL
ESPAGSTDSQCSCLFKCRKSGPFPGTIETGNSTKARPVPYAALPVVSAEIDRLTNTGVIT
PIEHAEWAAPVVAVSKKNGSIRLCGDFSTGLNDSIETNNHPLPTADEIFAKLNGGLYFTQ
IDLADAYLQCEVDEQAKQLLVINTHKGLFCYNRLPFGIEAAPGIFQQFMDKLINGLDGTS
AYLDDLIVTGSTIEEHNSRVHKLMQKIQDFGFRIRMEKCSFLQHEIKYLGFIINKDGRKP
DPEKIQHIKNMPKPENVSQLRSFLGLVQFYGTFINDFFNLRPPLDALTKKDADYTWTPEC
QKSFEQIKEILQSDLLLTHFDPKLPIIVSADASQYGIGCVIAHRFPDGTEKAIYHVSKAL
TKTQQNYSQIKKEGLGIVTAVTKFHRFLHGRHFTLRTDHKPLLAIFGGKQGVPVYSANRL
QRWAITLLNYSFDIEYINTKDFGQADALSRLISEQGAAKEPEDQIIATIEVDMADSVTHN
LQCRPARDTEMSTVWSLARFEKNTDQWILANRKDEMAGIQECLMIGERIVIPATLRNKVL
KTLHRAHPGIVRMKQLARSYVYWPGLDNDIEKLVKGCDSCARASKDPIKNTLFSWPMAKS
PWERVHADFAGGPIEGKYYLLIIDVYSKWPEIHAMSSITSTATLKIMRRIFAQFGNPAVL
VTDNGSQFTSAQFKEFCVQHGISHIRSPPYHPQSNGQVERFVDSFKRTLIKLEGEGSTEV
AVQKFLQAYRSTPCSASPNALTPAENFLGRKIRTVLDLLLPSCPDLTPQRNLKMERAFDL
QNGARPREYDIQDKIYVKINSNQSTATWLPGIITGKIGYTIYEVSVNGGTVKKHTNQLRS
RATPTPYPELVDWLTLEDNEVDRTPLTRSPAPAPQVNPPASLAPAVPLRRSARNPKPTVS
FQLDPSKKSYHQK
Download sequence
Identical sequences G0P793
CBN12555 135651.CBN12555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]