SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN12621 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN12621
Domain Number 1 Region: 450-884
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.71e-125
Family Reverse transcriptase 0.0000496
Further Details:      
 
Domain Number 2 Region: 955-1107
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.15e-37
Family Retroviral integrase, catalytic domain 0.0071
Further Details:      
 
Domain Number 3 Region: 315-409
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000124
Family Retroviral protease (retropepsin) 0.0094
Further Details:      
 
Weak hits

Sequence:  135651.CBN12621
Domain Number - Region: 251-292
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000145
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN12621
Sequence length 1272
Comment (Caenorhabditis brenneri)
Sequence
MASLEEQIATLTQAVATLAQLQAQQAQTHAQAPTATGAPRLFDQISNRIPQFVYDPELDK
TFDLWYVRYKDVINKDGQTLSDEEKTRIILSKISDTNYTFYSNRLLPKTPTDFNYTETVD
LLKKTFKSTSSIFKKRQEFLRLEYDGSSIEEYTGTVLRKFTSSEFKKMSEDQICCMVWIA
GLRDVALNDMRTKALQTMEAKPDITLLELEAEVKRLMDIRADSKTIASPTNGINLVRKHQ
QKKGSGSKYDKPPPSPCPGCKGSHWLKDCPNPKTECRKCKKLGHKEKDCRVKTWSQNKKE
EQKINSVIVRAATTTGANRIYRIVQVNGKPITMQLDTGADVTLFNEADWKKLGQPKLQKP
TISVRSANHQPISVKGWFSCHVTMGNEELCLKAHVADTETLLGIDWMARDQKLWNILNDS
HQINHVGSTTGSACNYLDGAREQLRRSMENEYPQVFQSGLGKCTKLKADIKLKPNATPVF
RKARPVPYATLPAVSEELDRLTQQGVLTPVDHSAWAAPVVIVKKKNGSIRMCADYSTGLN
DSIEQHRHPLPTADDIFTIINGGKYFTQIDLAEAYLQIELSDQAKDLLCINTHKGIYQFQ
LLPFGVKSAPGIFQQVMDQLINGIEGAAAYLDDIIITGSTIEEHNTRLKKVMSRIHEFGM
RMKLEKCKFLIEEVRFLGFIVDENGRRPDPEKVKAIKNMPVPKDITQVKSFLGLIQFYGA
FVNSLFRLRPPLDALTKKETPFVWSRDCQQAFDKIKDVLQSDLLLTHFDPNKPIIVAADA
SKDGIGGVLSHRFPDGSEKAVFHFSKALNKAQTNYSQIEKEGLALVTAVTKFHKYLHGRQ
FTLKTDHKPLLSIFGDKKGVPVYSANRLQRWATILLNYQFKIEYVNTLAFGQADALSRLI
AEKENGLEHEDQVIAQVEADIADTLEYGCHQFPVNARIIRQLSKKDATLQEVAKWQRVHA
DYTGPLNGKYYLVMVDAYSKWPEVHTTSSISTSSTVKLFQKVFSQFGVPETLVTDNGPQF
ASSAFNQFCVEQGITHVRSPPYHPQSNGQAERFVDSLKRALGKLKGEGTCDSALNLFLQS
YRSTPCDSSPNQATPAENFIGRPIRTFLNQLLPSVDPRPSDHNYTMEAQFNRQHGARAKE
FDAHDKVYVKDYRNLNAPTWTSGIVIRRLGKTLYTVRVNGSAIWKRHANQLRKRGSLSQP
EDTPMDLLEGPQNREESETSDISHMPLSSPAPVSSPVPPPPPTVVPRRSTRTTRPPSRLT
VDPTKKSYTSLN
Download sequence
Identical sequences G0N3L6
CBN12621 135651.CBN12621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]