SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN12650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN12650
Domain Number 1 Region: 386-486
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000471
Family Anti-sigma factor antagonist SpoIIaa 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN12650
Sequence length 636
Comment (Caenorhabditis brenneri)
Sequence
MNQEDYDRQNGFNREEPPNWIRRKWDRIKEGAQLSGVGRMIEHRIPIIGWLRRYAVTDNL
LPDVVAGTTVGIYVVAQDYPGVTNIEIAASLCLLTGMIQICLALTKFDVLMTFLPKPAVD
AITVSAVFYGIVSQIPKILGFSVKSSDAPYFSLFHSVYEIGVNIVSLNINWPTAIVSFVT
LVYLIITQFFEKLWKRSFKAIPFPRELIMLALAIILSDALNLDSNYHVKTIKTIPSGFQS
PLLPRLDIMSHLFLNAVSVAVVSYAITISMGDVFSRKHNYIMDTNQELLALGLTNFGSSF
FGCFPTCCSLSRTLVNEKCGAKTQLASIVSSAVIGIVVIFLGTYLTPLPICVLSVLVCFV
VIPFLVNAGELPRLWKCSKHDFATEFRIIRFDAPLIFTNVKKFSHNIRSAMQDTKKRRKS
IESQEGVKWTAIILDCHTWTYTDTMGITAVQDINEDLQKLHILPLFANLKSSLRRQYERA
GILEEVLVYEHEVLELEVKVMAEDRRITEERDKLARNTVRYANGTNRKDKIDPEAGLYNG
EAVQVEMKHEQTEHQLLLDEIQLNKEKRCLAAKKEKLAQQIKETERKKEGKSEKNAESSM
KISQNQIYPSIQDALKAAHELVIKQNEFFKERVQQD
Download sequence
Identical sequences G0M6H2
135651.CBN12650 CBN12650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]