SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN12817 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN12817
Domain Number 1 Region: 138-240
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 2.22e-25
Family Elongation factor TFIIS domain 2 0.0075
Further Details:      
 
Domain Number 2 Region: 22-94
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 5.62e-20
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0011
Further Details:      
 
Domain Number 3 Region: 262-307
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.7e-17
Family Transcriptional factor domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN12817
Sequence length 309
Comment (Caenorhabditis brenneri)
Sequence
MTALEQTQALCVQVDDICQNGMESAEDCIKLLDELAKIPMSVEIIQKTNIGIKVNTMRKK
VSDEAIAKRAKNIIKEWKNIVDGKGKSQDDGDAPPPAKKQRKESVEAPKPEKKKLEAPFK
RPEPSNRPEIVAQFASAAFPPKHLENDETRLKSAQLLLSALRSGEMPQGTLDPEELAVQI
EEKLHSVHRGTNKNYSAAVRSRIFNLRDKKNLALRENVLTGVVRAEKFATMTSEEMASPE
IRNMRDKFTKEAILEHQMSVQQGTPSDMFKCGKCGKKNCTYTQLQTRSSDEPMTTFVFCL
ECGNRWKFC
Download sequence
Identical sequences G0NNZ9
CBN12817 135651.CBN12817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]