SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN12970 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN12970
Domain Number 1 Region: 70-310
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-45
Family Voltage-gated potassium channels 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN12970
Sequence length 631
Comment (Caenorhabditis brenneri)
Sequence
MLTTSGYPNGATLSIDDSPQDQDESETFLLGMVTGDGLGKMFNARYRNIKEKKAAKMTYR
ALIYNCLERPTGWKCFLYHFSVFLIVLICLILSVLSTVEEHSHFAAELLYILEIFLVIFF
AIEYIVRLWSAGCRSKYIGFWGRLKFARKPISFIDLCVVLASFTVICIGSEGQVFATSAI
RGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDH
VGVDGRQAFTSYADALWWGVITMTTIGYGDVVPQTWLGRIVASCFSIFAISFFALPAGIL
GSGFALKVQQKQRQKHFNRQIPAAATLIQCLWRCHAAEKRVSATWNAHVDPLAHETKETH
GHAKKQQQQANDTNHVTRKRQLFKKQSSLVNTFRRKGSPSTDVEMGELNHQERLLRHERN
SDTDDEKRVYRVGTDIEIEYETEEANTPTKLHPDSHISHVCELTEAHRNAIRAIRKVKYF
VARRRFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDQTLGKPGQYDGKGSRKGHP
VTIGSRLSRLELQMASLDRKVESSNRTLNALYRLMADRNSLTISPSPPALISRPVSPANC
LSPRDQLSPTSISSQRSGSPSYTLDPNGGWH
Download sequence
Identical sequences G0MQB7
135651.CBN12970 CBN12970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]