SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN14860 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN14860
Domain Number 1 Region: 78-120,189-254
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-22
Family Voltage-gated potassium channels 0.0048
Further Details:      
 
Domain Number 2 Region: 258-361
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000222
Family Voltage-gated potassium channels 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN14860
Sequence length 504
Comment (Caenorhabditis brenneri)
Sequence
MQNLPLARSNSSTSLSKAEAVEKYYERNAHTVSGMHKNQDTIGQLQRRYKPKQDTLSILS
SPGALGETVVPTPRHFDRSMYWFAFHRKQIGLRHIIVALMVLSYTIFGAFIFWSIESRYE
RAITLERVTNLEKLLGSIAENITEIVNDPYTNTTESEMKVYIREAYVTLMRLEGQYKGST
YYKLEDHGRNWKWTFESAFFFSMNVYTTTGYGSIAPESTLGQLLVCVYGFIFVPVTLVAL
RDLGQFFLVHLTKLYAELIQRFRELNGDRNVDVNEIIKIPIKACLLLLALYLAFCTIFIH
LFDELKGQEAGSGMSLFLCFYFSFISLSTIGLGDIMPNNATFSPIISIMFFFGMALTKVV
NRNTFIAVENGIFGVLTLVENKLDGIVRRGRFQSEEKQEKPEKQQKPPKPPAPTGPPTFQ
RALSVEDYMAAQRENTNDVLNNLTVRSIATFMKSNTDIYGGGFGRVQLRRGDLMGSDHQM
TTTSVDKEASNHHHHPHQNPDSAV
Download sequence
Identical sequences G0NF76
CBN14860 135651.CBN14860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]