SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN15300 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN15300
Domain Number - Region: 65-103
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0628
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN15300
Sequence length 416
Comment (Caenorhabditis brenneri)
Sequence
MSEDGELSEVSGALDDNESFVVDRNCSGIIPNEDLIDKDTEESSQDSVPITPQSDWSKRM
RKRLLGDTNPTEEPQNKRRRAANLCFNCRGEHSISQCPEPKDFAAIRKNKAEFLSEKQTV
QNGNGGRISKITEQDAKFKPGRLSQNLRSALNLGPDDIPEWIYRMRRMGFHGGYPPGYLR
KSLKHEFGTLKIFSDDAKKNDEIDEEPRPAPTIQSEKVHFYMGFNKTYGALRDRERGQFE
VPPFDIFCEMLQTVSAHLWTGMLILSFQEVTKDHEYSEKNRIRDERQQRLELQKLREEEI
KNQIDDIVVVDRSKTEEVEEVVTPRKSKETTPEREEGRMGESIHQLIGTPIVSHRDENGS
VIEYTTPSLEAFAVGILPFEAKEEEKPRGIFKRIMSTLRGIVKKDDDDDEKKKKND
Download sequence
Identical sequences G0NMH7
CBN15300 135651.CBN15300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]