SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN15395 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN15395
Domain Number 1 Region: 449-754
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.05e-81
Family Reverse transcriptase 0.0000568
Further Details:      
 
Domain Number 2 Region: 329-418
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000375
Family Retroviral protease (retropepsin) 0.015
Further Details:      
 
Domain Number 3 Region: 256-301
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000002
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN15395
Sequence length 759
Comment (Caenorhabditis brenneri)
Sequence
MVNMMALLRKQMAEQAKRHEDSLQAITQMFAGIGMPVDKASEPTSGSQSQLISEIGSRIT
VFQFDLEAEKTFSKWYARHGTTISEDGKALEDKNKVSLLVGKLSDDVFEQYSKRICPKRF
IEFSFDETVETLKSMFDIEKSLFSHRFACINIARDGDTPVEYTNKVNSLCELAMRKDTLR
GLDSNADKQMRTYFIKLVEQKWEQKEVVKINDLCSEWQKMLRQNSVSLEIGKTEAAVKAV
HTKGHGGKSSNKKPNREDSKEEACWNCGKSGHKKPDCTQKITKCFNCQKLGHMAKFCKSK
KQNSTKRTQNVVVVEGGASDELSVNCVRQYVSAEVNNEIIEFQLDTGSDITLVGREDWIK
MGEPRLEKCSTKVKSASGNEIKLLGRALVQFTLKGSKGSGYVYVRESANLLGLDWIEKSS
EMSYHMGMMVNALKSEDTEGIQEELKVNFPEVFKEGLGTCTKEQAVLKVKPNSKPVFKPK
RPVPYGALEAVEKELDRLEGLGVLKKVNYSQWAAPLVCVRKAGGDVRVCVDLSTGLNDAL
EDEDHPIPTPEDVFATLNGGKYFSNVDFKDAYLQVELAEESRHLFTINTHKGLFEYQRLV
FGAKTAPMVFQRIMDKMITGLSGVKAYLDDVIIVGRTEKEQKDNLFKLFERISEYGFRVK
LEKCKFLEKEIKFLGFIIDKDGRRPDESKVQVIKGMCDPKNQKELRSFMGMITYYSAFIP
KMKTLRGPSDKLLMKDVEWKWTKVEVESFQKLKIYCLLT
Download sequence
Identical sequences G0P7A1
135651.CBN15395 CBN15395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]