SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN15729 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN15729
Domain Number 1 Region: 32-140
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-26
Family C-type lectin domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN15729
Sequence length 154
Comment (Caenorhabditis brenneri)
Sequence
MNESSLIPTSSLSDSSSADLSVLSDAVGTAACASGWKRYSVNGMCYKESSTSMSWYAAED
WCWGQRAGAHLVSVHSQAEAQWLNSQYKVWYAPMDDWIGLKKECDMGKYFWTDGSPVDFT
WWQPGYPKAQYAEQSYLEYSIVASCFWIHTGAIR
Download sequence
Identical sequences G0NC73
CBN15729 135651.CBN15729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]