SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN16560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN16560
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.77e-25
Family Ubiquitin-related 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN16560
Sequence length 73
Comment (Caenorhabditis brenneri)
Sequence
MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHITLMDY
EIHEGFNFELYYQ
Download sequence
Identical sequences A0A1I7U5S4 A0A261CAB6 A0A2G5VV40 A0A2H2IB40 A8XKY6 E3LXE3 G0PP08 P91302
NP_491640.1.50509 XP_002639087.1.8413 XP_003111297.1.11157 F46F11.4 F46F11.4 F46F11.4 135651.CBN16560 281687.CJA11099 31234.CRE03637 6238.CBG14905 6239.F46F11.4 CBG14905 CJA11099 F46F11.4 CRE03637 CBN16560 CE10602___KOG3493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]