SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN16863 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN16863
Domain Number 1 Region: 474-605
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.89e-29
Family Reverse transcriptase 0.0024
Further Details:      
 
Domain Number 2 Region: 323-413
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000102
Family Retroviral protease (retropepsin) 0.011
Further Details:      
 
Weak hits

Sequence:  135651.CBN16863
Domain Number - Region: 258-300
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000879
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN16863
Sequence length 620
Comment (Caenorhabditis brenneri)
Sequence
MEELTKQMAALVATFQTMAQNGQIGTAPQTIPTAEATNNHRLLESLSARIPKFTYEPEED
LTFENWWGRYENIVVKDGETLPEDSKTRLLLDKLDSKAYTLYANRILPKNPTEISFNDTT
KTLKTLFKSTTSVFRKRQDFLRIEYDGTGIEQYTGKVLRGFTSSEFKIMSDEQVCIMIWI
SGLRGEAYQDIRLRALQLIESKPAITLLELEAEVKKLIDIKTDAKSMSGIKPQAEANAVH
KSKKQPNKTKKPEKSQKKSPPSPCYRCNGNHWARDCEWKEAECHFCKKPGHLEKCCRAKQ
KDTTKTPKVKSIKVEAAKSVGINRIYKKVEINGHPISMLFDTGADVTLISRNHWTQLGKP
KLQKPSITIKSANHQTIPILGSLNCNFILNGNNAQGVAYVTDTDTLLGTEWIKTDQSLWN
HIQDPRMINAVSPKTPTSAEKLAASRDLLKREIQSEYNSILQPGLGKCTKGKATLELKQN
EKPVFRKARPVPYATLPVVSAEIERLTNTGVITPIDHSEWAAPVVAVSKKDGQIRLCADF
STGLNDAIETNNHPLPTAEEIFAKLNGGVYFSQIDLAEAYLQCEIDDDAKKLLVINTHRG
LFCYNYKIQQLSELKHRHLR
Download sequence
Identical sequences G0P4S5
135651.CBN16863 CBN16863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]