SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN16953 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN16953
Domain Number - Region: 10-71
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0432
Family DBL homology domain (DH-domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN16953
Sequence length 81
Comment (Caenorhabditis brenneri)
Sequence
MSTFEKTALFSTNSTNILPASRILLHSVKTIDELQQIRGLLVNWGPLLTLHFEYLERYLL
WVSSVSQGVLHQFFAADLSNF
Download sequence
Identical sequences G0PF01
135651.CBN16953 CBN16953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]