SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN18037 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN18037
Domain Number - Region: 434-460
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0272
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN18037
Sequence length 483
Comment (Caenorhabditis brenneri)
Sequence
MSTPSKGNKVNDDVVETPQVGALEEVRTSTPVPTEDDELVPKDADGNIYPEESAGGTPTG
TPRKDNDIVEEQKEEPPSEDEEKEDSDEESCGEEQREDSPSPNPTLPEQDVFTASSGPLT
PQMIAGAPDQDKLHRASNLIKMSEPLRKLLKSHAREPKTANSTPSRVPNQDELKALHREL
TLTLANNQVEMDMRQLVLGTQSQIAQIKGSFVGFHDALERLLKQSTVTHGHNILQEDAIK
AGLAKLEQDVRSSWMSQAKNRAAIEGNGKAIKELAKEISDIINMLREILARVPNFFPLGN
PKEPSNWIPSGHGAPGTSPMDPALTRKQWEQLLLEYKEPSTWTTNGQGTSGPTPTGQAPT
VSNKQSGQLPANREPTKKPNAPKKALECPFCCGSHRSYKCEVFTTWQARRHFLLTERGCL
KCLKMAVDKSNHVCDREKASCFLCHKLGHHSSVCENNPQDNNEQQPPAKKAKYASNKDTT
KRK
Download sequence
Identical sequences G0MSP1
135651.CBN18037 CBN18037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]