SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN19686 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN19686
Domain Number 1 Region: 1109-1261
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.28e-36
Family Retroviral integrase, catalytic domain 0.022
Further Details:      
 
Domain Number 2 Region: 808-910
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000326
Family Retroviral protease (retropepsin) 0.038
Further Details:      
 
Domain Number 3 Region: 688-724
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000959
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN19686
Sequence length 1519
Comment (Caenorhabditis brenneri)
Sequence
MQPTTGSADPNKEQRETSGRDNRDFKVNVVGSVEGAATGRSVTSSGGARRPPSLAFRSPA
PTNNPSSHFLSSTSEGDAVANTKEHEPKGDVTGNSGNQIVQREGASESPTGIKRTFETRT
GPDSARGHHHSTMVRNESRGMEMAKSIDEEHKSSSISPNKSVTAIAIRKESLDGTDPYKQ
MEQCAPIDVVHAHPPSSNKVILKKLPTQTGGPTQDHVDITKQPKTAKGSPIKPGNHYIPV
KQSYVQSANGEGGLDNHPSQLGSQSLDNFSPTPASRLTTQEINKTVQPGDQQSTKRAEGQ
DEQNRSIKPVRPKVLDTNPLEDQDKIKTKDLGTIKTKDQEKIKLEDLKTIKQTDQDRIQP
VKETNPHKSLNTGGEASKAKTNQARIFTTTPAKDQNNQSNEEAEDQRSSKGSTGSTTPSD
TRVKDTTKEQLHDHLTAATTVIESRKATGSAATSSTRTSKHTNQTYPQVMTINFKQSSFK
LGSLQPFSGAATDPCFSDWVRKYKNCVTASGEQDTDDHTAVCKFLTHLEGRVLDHAEEFK
AVNPTTTLDQLITELEGLLEHEAYRNQAREQFNKIAQGDHESVEDYQTRFAKLAKRSFGN
SPDSTIQKIILARFVQGLRLSIRRMVVTSRPPTLQEAVKAAIEFQPHEDRSRDIASDTAD
IKATVYNIEKRLEEKVTRQERQRWRSHSPKADKSSSRFASSKCYKCKKIGHISKYCYDKL
GRKEAKRRMREDNVKTSKTRKPAENHRQQGPTVCVTDGGQEEIARLREQIRNLTLQNQQL
AANRYDSNERTPEVKQLNDKADNIISQVPIRANGIATAALIDTGSNITVAGNQLCASLGI
STLDYLGSGCATGLGNNSVAMAGSALVTLKIGSKTYIHRVHFTDGPCASGGKDSYTIIIG
NDLLKKMPMIKIDYRSKRLWIGKEALPLGVKKSTTKTSPATVYQIAVKEDITHVPTCMVI
QAGPEVFIAHGSSNGLSLAKAQEKDPEIQRVKKYLADPSSTDDLPEHWISIAHLLEVSEH
GTLKINFNETGQKTIVPEQLKKTIYKSFHENAASGGHLFWKKSLEKAQRRYYWPNMQKNF
FEWTRQCLPCQRRRSVHPSARELQAIVCTSAVFEKVGLDLTGPLRESTNGNRYYINVVDW
FTKYVISVPVKDATSGTVAKVLLEEVILKYGTPAQLISDNATGFTSGEFNNFKTLLKLEH
HFSIPHHSRGNGATERTFRTFHSMVAKYINSKHDNWDTILPCVTFAYNSAVHSTTGESPF
YLMFGRDPVFTIDRMLNDPPSDDGDDSAYTGNWRECITSTLRKAWKVAEDHSRLAQLAYQ
KSANKGALGSGIRLGDRVLIKNYKSKVGQSRKLVQPWIEGFRVIEMSSSKNSRGEVIIQQ
ISDPTVTKRVHLNQIKKHYVAEEEPKKKKKDAKETKQPTQSTPAETTEEASADVDAKEVT
TPLEILKPTLDAPTLPLKLKEIKEIRKSKKSAKAKKDKQDKQDKPAKPAGPAKPDPSTKE
ETSARRNPERQRRAPARYL
Download sequence
Identical sequences G0NDX4
135651.CBN19686 CBN19686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]