SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN19781 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN19781
Domain Number 1 Region: 456-751
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.2e-61
Family Tandem AAA-ATPase domain 0.0000443
Further Details:      
 
Domain Number 2 Region: 166-219
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000733
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 
Domain Number 3 Region: 273-318
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000221
Family Retrovirus zinc finger-like domains 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN19781
Sequence length 797
Comment (Caenorhabditis brenneri)
Sequence
MTDTDGWDDAPAKPSGGNTGGSGFGGKSSGFGNSGGSGFGGGNSGGFGGNSGGSGFGGGN
TGGSGFGGGNTGGSGFGGGNTGGSGFGGGNTGGSGFGGGNSGGSGFGGGKSNGFGGGSSG
GGFGGGGNCTSFGGGNTGGGFGGGNSGGFGGGSSGFGGESGGYGGERGERNNNCFNCQQP
GHRSADCPEPRKPRDGGAPRNCYNCQQPGHNSRDCPEERKPRENRGGGGGFGGGSGFGGQ
SGGFGGGSGFGEAGNDGGFGGGFGGESGGFGGGEERGPMKCFNCRGEGHRSSDCPEPPRG
CFNCGEQGHRSSECTNPPKPREHAEGEGPKATYVPQEDTMEDVFNMQKISEGLMFNKFFD
AEVQVTSCGKNCKVTAVRTFNEAELTETMRKNVQHAGYNKTTPIQQYAIPLIRSGHDIMA
CAQTGSGKTAAFLLPIMSRLMDDNDLNTAGEGGCYPRCIILTPTRELADQIYNEGRKFSY
QTMMEIKPVYGGLAVGYNKSQIEKGATIIVGTVGRIKHFCEEGTIKLDKCRFFVLDEADR
MIDAMGFGNDIETIVNYENMPKKEDRQTLMFSATFPDSVQEAARCFLKNNYTMITIDKIG
AANKCVVQEFEACERSEKKDKLLELLGIDIDSYSTEKNAEIYTKKTIVFVSQRAMADTLA
AILSSAQVPAITIHGAREQRERSEALRHFRTGTKPVLIATAVAERGLDIKGVDHVINYDM
PDNIDDYIHRIGRTGRVGNSGRATSFISEDSPLIPDLLKVLADAEQNVPEWMQGHAAGNY
GATGFGSSVQTQEDEGW
Download sequence
Identical sequences G0MPP3
CBN19781 135651.CBN19781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]