SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN21431 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN21431
Domain Number - Region: 128-154
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00152
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number - Region: 94-125
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0942
Family Retrovirus zinc finger-like domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN21431
Sequence length 254
Comment (Caenorhabditis brenneri)
Sequence
MNIPKAKETAHSLRVLHNELSAILSSLKAYEKIESQNFQSIIRKKIPSSILIDILKSKPT
STTELLNALDAATSIEEAAQRSETLEKQDKSVFTVKKAQPQTQQKTCKFCNRKNHSTVEC
KTVRTLEDRKEFIKNNNLCFNCMNSGHRLHDCKSNACRKCNTKHNTAICPKNQNIERKSE
YQRNKESSAPHKPSYSSNQNTDQRFNQRNSRPINTNWKPNQGTYSPQQQQQKTAQNRNEN
HRNQVTKSIAIKLH
Download sequence
Identical sequences 135651.CBN21431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]