SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN21642 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN21642
Domain Number 1 Region: 46-113
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.16e-16
Family Cold shock DNA-binding domain-like 0.00067
Further Details:      
 
Domain Number 2 Region: 137-181
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000127
Family Retrovirus zinc finger-like domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN21642
Sequence length 214
Comment (Caenorhabditis brenneri)
Sequence
MSTVVSEGRNGGNERYSPQDELPDLENLKLTDDMRVPSFDRLPSPTPRYYGSCKWFNVSK
GYGFVIDDITREDLFVHQSNLNMQGFRSLDEGERVSYYIQERSNGKGREAYAVSGEVEGQ
GLKGSRIHPLGRKKAVSLRCFRCGKFATHKAKSCPNVKTDAKVCYTCGSEEHVSSICPER
RRKHRPEQVAAEEAEAARIAAETAASSPRGDHDE
Download sequence
Identical sequences G0PDY2
CBN21642 135651.CBN21642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]