SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN22293 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN22293
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000353
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 151-221
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000275
Family B-box zinc-binding domain 0.0068
Further Details:      
 
Weak hits

Sequence:  135651.CBN22293
Domain Number - Region: 109-140
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0366
Family TFIIH p44 subunit cysteine-rich domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN22293
Sequence length 386
Comment (Caenorhabditis brenneri)
Sequence
MNQSAQKKEALECKICINPFSDTIESNIPRILGCGHTICHSCAESLQKVSLDKFSIRCPF
DRQITANFYGNVEKLLRNYAIIDLIQARNEEADRAEEIKAPEICEDPIVPCYENPKHEST
KYCQACEVDFCESCFLSVHSSKILSNHQSVPISEKPIRRQNCPNHPDSIADHFCDDVNCK
TTSPFCCETCRQDLHKDHAMILTEVKADKLERELTDLLKALDSFAIQAIQRGGTLDKTKI
CIQNIENLEAECQNMLTAIEEHFERKKMEASQKLINFRDSKFIYMENKEAIENGLELIKK
SKMDIVKVLKRKEILFADETIDFEKIYYGLNRVKHVDLVPLPMPTLEEIINSNSSTPSSA
PPNDSPAPPPTRTLRDLFSFSKFRFF
Download sequence
Identical sequences G0N3R5
135651.CBN22293 CBN22293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]