SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN22490 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN22490
Domain Number 1 Region: 449-553
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000175
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN22490
Sequence length 565
Comment (Caenorhabditis brenneri)
Sequence
MRKKEVAGWKNFIPITKWLPNYNIKQNLINDLIGGITVGILHVPQGMAYASLVGLKPVYG
LYTSLFPSLIYMFFGTSRHVSLGVFAVVSLMSGSCNLRVTQELAASSGSNLTKAELEVIS
VNVVKSLGLAIGLIQIILGLVKANYLISYLSDQIILGFTTGAAVHVLTAQLNKILGVALP
RHTGIGKLFFIYRDLINSILDDKVNKVTLAVSVVAIVALYVAKYHLTPALCAKTRIPIPY
DLFLIVIGTTVSSIFAANSNYHVKIVGPIPTGFPSPALPDVSLFGNVFGDALAIAIVSVV
VTVSMGKVIAKKHNYVIDVRQEFFALGIVASTCSMFPCWPASTALARTLINDNAGTKTQI
SAIFSALVLTLVLFFIGPLMEHLPTCFLSCIVIVALRGMFLHLQNFVTLWKVSKYDWAIF
SITFFSTVCLDVVPGLFIGTVSALLFSILRIQRQTCVMFFASSLFYFNCERFEKKVQKIV
AKFTGNNERDDNSAEIPMIEKKIKEKCIIFDMRGVSNIDLSGANTLIKIHQELKNKNITF
KIRDPNENVAAFLSGVSNSDQLFES
Download sequence
Identical sequences G0MI40
135651.CBN22490 CBN22490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]