SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN23269 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN23269
Domain Number 1 Region: 274-308
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000139
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN23269
Sequence length 375
Comment (Caenorhabditis brenneri)
Sequence
MSSSGEDESKSCSTMLKEYVRAHGRLPTNHDEFVKQHAQQQGLIMAKLESTAESIASINR
NQQLLLKQTAEIVAKSRKEKSMKTNDQEVQQQDQGGESIHSIEKLQKEATPESGPVVGKL
ELNQDKLYEQFRSFMKINESKQDEITAARRAKKIKKRKNLIAKQKAKKAELKRLETQNVT
KPTTPKVATPQIIVSDVPKAIDKPAEPKEEQPRIIFPPMKRTKSGWNLRSVTFCETPRVI
FPMKCVVCGTENNHSGDRCAIRLTIKNLWNHLEQRGVCRRCEGKGHLLKDCPYKRKLWCR
KCKRHGEQEDHSERLCPVKWEKQVDQYERHLERQKKKQKETSDDEDVEMIDDTQPGPSGI
DWNIKPQDDESMDFD
Download sequence
Identical sequences G0ND92
135651.CBN23269 CBN23269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]