SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN23811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN23811
Domain Number - Region: 502-537
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00141
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN23811
Sequence length 1211
Comment (Caenorhabditis brenneri)
Sequence
MTQVEETESFLEGREFEYLTLRERSRNEASMLVLGRNFMSNKINEFKTKSTQYEKNCKEF
KKPATSLSNKDKAAAHADISTACYEMSKDLEEEWINLQNCLIGTIESFNKIQGSTVIGVQ
ASSLINNWEDEIGIAEEGYRETVKQLISRHEKAKEAALGLGFRVPHENIGNQELVKDIEE
KFVKVSKSLEAQGSNYVQKKVGSSILSNKNIVLEDFDGEPENWSTFYDIFKPIVEENSEL
LEVVKFALLKKACKGKAGDMIKVFTSAENFKEAIDRLKKNYEDKDRRFTMLWDRLEELRP
AKDQVASMRKTINEVAAIVAALKRVTDIETLALRQLVKRKFPRKIHEELSRAEDIKTTQD
MVDKIEQTINREERIEKDMVSTQNMSKTFITQHENPDRNRSMRYRSRSNSEPRSREQGNI
RHWRGNEMRNRDRNRQSSRTPSRPQRGYYAASGGRDRSWSRGRDFRKSPHPNKQSSDCLF
CSKDHRSRDCRKVNTIEERTKYFRENRMCFNCGKMDHAANKCSGGACYQCGKNHHNSLCR
KNKVRTDSSESSREGRDRRRSYSRESNRYSNRDRSRDSSRGRRDYDRRNRYDNNYRDRNR
DYNRDGSRQNSADRSRSSSSERYVGNNRTYRNTYSNSYSRANTVRSKETRLMTVTGRLIS
EPSKTYPRKRTKEARTLIILDTGADQNYIEEGLAEFLRAKIVEKNKTITLATVGEEKEIQ
SHKVRVELLTEEGIVRVEAMTIPSITTGFKRTSIDRKEKEYLYKKRIRYEVPRETEAGLL
IGVDTFWKLMKNKDYIKLPTGRTLVSTKLGNVICGSIRYVEDEYNRRYLLAKHSKVTISD
KEEDKTLEITGEEHSSQKYIGITENPVSPKIEELKYPVYDDEKLKGEYREYTYRLREGLK
YGNRTVEVKTKNRENIKRRIEQLIPSEIRSNSDNTSHQVPEQQYIVPKEDKEDYQERRQM
HCHQQGMCRSCCPQPQGYHLCMQGPQQHFHPPAPQPYYSYPYTPQHYLPQPYQCLSQFPP
QQQYQHYSPPEYNQYDQINQNRNRSISPPQYNNRPRNSSFGSPPRFPRRSSPVQYRKDRS
PTPPREKKCHLCRGPHLARNCWNSTAAIRLIRADLAGLCIICLNKDRHKPEECRFNNPGN
KYLCKRGCVGFPPHAISLCVGDRVSPDSESSGSVRNGEGEVEVSARDAATERSTREPEEL
IKKGDELATKE
Download sequence
Identical sequences G0NET4
135651.CBN23811 CBN23811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]