SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN24090 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN24090
Domain Number 1 Region: 81-196
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000491
Family Anti-sigma factor antagonist SpoIIaa 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN24090
Sequence length 207
Comment (Caenorhabditis brenneri)
Sequence
MCILACIVIVSLKSLFLQVKELPRLYNISKYDFAIWLVACLSTVFTDVTTGLVISLVSSL
FTLVLRQQWPTFSNSIQHDETPRQNIPDGVEIVRFGGSLHFANVTLFLDKMGESIGRVPE
GESLIEGRCIILDGSPIAYVDTMGVDALKDVYKDAQKTGVQIFYCGLPEDVLSVLRNDEN
FSSVVPASTFFASIDRCLLSLVQQQSV
Download sequence
Identical sequences G0PLB8
CBN24090 135651.CBN24090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]