SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN24447 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN24447
Domain Number - Region: 504-537
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00199
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN24447
Sequence length 1205
Comment (Caenorhabditis brenneri)
Sequence
MTQVEETEPFLEGREFEYLTLRERSRNEASMLVLGRNFMSNKINEFKTKSNQYEKNCKEF
KKPAASLSNKDKAAAHADISTACYEMSKDLEGEWINLQNCLIGTIESFNKIQGSTVIGVQ
ASSLINNWEDEIGIAEEGYRETVKQLISRHEKAKEAALGLGFRVPHENIGNQELVKDIEE
KFVKVSKSLEAQGSNYVQKKVGSSILSNKNIVLEDFDGEPENWSTFYDIFKPIVEENSEL
LEVVKFALLKKACKGKAGDMIKVFTSAENFKEAIDRLKKNYEDKDRRFTMLWDRLEELRP
AKDQVASMRKTINEVAAIVAALKRVTDIETLALRQLVKRKFPRKIHEELSRAEDIKTTQD
MVDKIEQTINREERIEKDMVSTQNMSKTFITQHENPDRNRSMRYRSRSNSEPRSREQGNI
RHWRGNEMRNRDRNRQSSRTPSRPQRGYHAASGGRDRSWSRGRDFRKSPHPNKQSSDCLF
CSKDHRSRDCRKVNTIEERTKFFKENRMCFNCGKMDHAANKCSGGACYQCGKNHHNSLCR
KNRVRFDSSESSREGRDGRRSYSRESNGYSNRDRSRDSSRERGNYDRSNRYDNNYRDRNR
NRNNNSDRSRSSSSERYVGNNRTYRNTYSNSYSRANTVRSKETRLMTVTGRLISEPSKTY
PRKRTKEARTLIILDTGADQNYIEEGLAEFLRAKIVEKNKTITLATVGEEKEIQSHKVRV
ELLTEEGIVRVEAMTIPSITTGFKRTSIDRKEKEYLYKRRIRYEVPRETEAGLLIGVDTF
WKLMKNKDYIKLPTGRTLVSTKLGNVICGSIGYVEDEYNRRYLLAKHSKVTISDKEEDKT
LEETGEEHSSQKYIGITENPVSPKIEELKYPVYDDEKSKGEYREYTYRLREGLKYGNRTV
EVKTKNRENIKRRIEQLIPSEIRPNSDNTSHQVSEQQYILSKEDKEDYQEKKQMHCHQQG
MCRSCCPQPQGYHPCMQGPQQHFHPPAPQPYYLYPYTPQQYLPQPYQCFSQLPPQQQYQH
YSPPEYNQYDQVNQNRNRSISPPQYNNRPRNSSFGSPPRFPRRSSPVQYRKDRSPTPPRE
KKCHLCRGPHLARNCWNSTAAIRLIRADLAGLCIICLNKDRHKPEECRFNNPGNKYLCKR
GCVGFPPHAISLCVGDRVSPDSESSGSVRNGEGEVEVSARDAATERSTREPEELIKMVDE
LTMKE
Download sequence
Identical sequences G0MKW0
135651.CBN24447 CBN24447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]