SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN25839 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN25839
Domain Number 1 Region: 448-882
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.45e-123
Family Reverse transcriptase 0.0000418
Further Details:      
 
Domain Number 2 Region: 1062-1216
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.7e-38
Family Retroviral integrase, catalytic domain 0.0055
Further Details:      
 
Domain Number 3 Region: 316-409
Classification Level Classification E-value
Superfamily Acid proteases 7.29e-17
Family Retroviral protease (retropepsin) 0.01
Further Details:      
 
Domain Number 4 Region: 255-294
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000055
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN25839
Sequence length 1384
Comment (Caenorhabditis brenneri)
Sequence
MATLEEQIANLTQAVAALAQLQTQQAQAQAQAQAPTATGAPRLFDQIANRIPQFTYDPEV
DKTFDLWYARYKDVINKDGQNLNDEEKTRIVLSKLSDPNYTFYSNRLLPKNPTDFTYTET
VDQLKKTFKSTSSIFKKRQDFLRLEYDGTNLEEYTGTVLQKFTASEFKKMSDDQVCCMVW
ISGLRDTSLNDMRTKALQAMEAKPEITLLELETEVKRLMDIRADSKAIASPTTGINQVRR
HQPKKEFSSKFDKPPPSPCPGCKGSHWLKDCPKPKIECRKCKKTGHIEKNCRVNSWSQES
KVNSIIVGAATTPGANRIYRTLQINGKPIKMQLDTGADLTLISEADWKKLGQPTLNKPTI
SIRSANHQPIEVKGWFSCTVTIGNDEKPLKAHVADTETLLGTDWMAQDHQLWNLLNSSQQ
INSVGSPTGSACAYLDSVREQLQKSLEQEYPQVFHAGLGKCTKLKAEIRLKPDAKPVFRK
ARPVPYATLAAVSDELDRLTTQGVLAPVDHSSWAAPIVIVKKKNGSIRMCADYSTGLNDS
IEQHRHPLPTAEDIFTIINGGKFFTQIDLAEAYLQIELDDQSKNLLSINTHKGIYQFQRL
PFGVKSAPGIFQQVMDQLVNGIEGVSAYLDDIIITGGTIEEHNIRLKKVMCRINEFGMRM
KLEKCKFLMEEIRFLGFIVDKNGRRPDPEKIAAIKDMPAPKDVTQVKSFLGLIQFYGAFV
KHLFRLRPPLDALTKKDTPFKWSRDCQHAFDKIKEALQSDLLLTHFDPTKPIIVAADASK
DGIGGVLLHQYPDGSQKAVFHISKALNKAQQNYSQIEKEGFALITAVTKFHKYLHGRFFT
LKTDHKPLLSIFGDKKGVPVYSANRLQRWATILLNYQFNIEYVNTLAFGQADALSRLIAE
NTNNLEHEDQVIAQIETDVVDTLEHGCQQLPVSAHIIRQFSKKDPTLQAVYKFVKSGHWP
RSIPKDTPLRDFYNRRGDLYIVHKCVMFGERIIIPTKLRNRVLRMLHRAHPGIVRMKKLA
RSFVYWPSIDSEIEKIVKSCDQCAAVAKDPTKNTLCSWPLTTAPWQRVHVDYAGPLNGKY
YLVMVDSYSKWPEVHMTSSISTSATVKLFQQTFSQFGVPETLVTDNGPQFTSNAFNNFCV
AQGITHVRSPPYHPQSNGQAERFVDSLKRALGKLKGEETDDAALKLFLQSYRSTPCDSSP
NQASPAENFIGRRIRTFLNQLLPTADPISSDRNESMELQFNRHHGARTKEFGPTEKVYVK
DYRNLSTPTWIPGTILRRIGQTLYSVRVDGNLSWKRHANQLRPRGSSPLTDTPMDMIDSP
QNLDESQTRADSDVSSVPSPVPVTCPVPTTTTPSPAVPRRSSRATGPPSRLVMDPTKKTY
TPLH
Download sequence
Identical sequences G0MBW5
135651.CBN25839 CBN25839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]