SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN25929 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN25929
Domain Number - Region: 10-48
Classification Level Classification E-value
Superfamily POZ domain 0.0051
Family BTB/POZ domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN25929
Sequence length 93
Comment (Caenorhabditis brenneri)
Sequence
MGYTVIDGVSYESEMVEKLEQAFAESDKTDAILVVSGKKLQVNKANLLEHALGLYNSKEA
FADLSSSGNRNFSDNLKLRIFNKLFENYDTFFK
Download sequence
Identical sequences G0MVY9
135651.CBN25929 CBN25929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]