SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN25935 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN25935
Domain Number 1 Region: 464-890
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.89e-120
Family Reverse transcriptase 0.0000501
Further Details:      
 
Domain Number 2 Region: 1070-1225
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.26e-40
Family Retroviral integrase, catalytic domain 0.0087
Further Details:      
 
Domain Number 3 Region: 327-417
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000528
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Weak hits

Sequence:  135651.CBN25935
Domain Number - Region: 261-303
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0217
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN25935
Sequence length 1382
Comment (Caenorhabditis brenneri)
Sequence
MDKDELAQQVANLVAALQAIAQNGQVANQAPTTPATDPTNNVSRLLDSLSSRIPKFRYDP
EEDITFENWWNRYQDIVTKDGATLSEDYKTRLLLEKLETKEYALYANRVLPKLPSEISFE
ESIKTHKLLFRSTTSVFRKRQEFLKIEYHGNGLEEYTGKVLRGFTSSEFKKMSDEQICIM
IWIGGLKGETYQDIRLRALQLIESKPAITLLELEGEVKKLIDIKTDAKSLSTANTKVVDV
NAVQKAKKKGENTAKTDKSQKKPPSSPCFRCKGKHWSSDCEWKEAVCNYCKKVGHLEKCC
ITKKREAKQSPKVKSVMVESAHSVGINRIYKDVEINGKAIPMLFDTGADVTLLSPTHWKE
LGAPKLQKASLQIKSANHQPIDILGYFQCNFVLNGNTGSGPAYVADTDTLLGTEWIKVDK
ILWNHLQDPQTVNAVAYSNAENLDHFREQLKLEIQREYKTVLQTGLGRCTKGKASLQLKP
DVKPAFRKARPVPYAALPVVSAEIDRLTNTGVITPIEHAEWAAPVVAVSKKNGSIRLCAD
FSTGLNDSIETNNHPLPTADEIFAKLNGGLYFTQIDLADAYLQCEVDEQAKQLLVINTHK
GLFCYNRLPFGIKAAPGIFQQFMDKLINGLDGTSAYLDDLIVTGSTIEEHNSRVHALMQK
IQDFGFRIRMEKCSFLQHEIKYLGFVINKDGRKPDPEKIQHIKNMPKPENVSQLRSFLGL
VQFYGTFINDFFNLRPPLDALTKKDADYKWTPECQKSFEQIKEILQSDLLLTHFDPKLPI
IVSADASQYGIGCVIAHRFPDGTEKAIYHVSKALTKAQQNYSQIEKEGLGLVTAVTKFHR
FLHGRHFILRTDHKPLLAIFGGKQGVPVYSANRLQRWAITLLNYSFDIEYVNTKDFGQAD
ALSRLVSEQGAAKEPEDQVIATIEVDMTDAVTHNLQYLPVSAEMIRAHTAQDVVLQEILK
CQKSGHWPRFEKNTDRWILANRKDEMACIQECLMIGERIVIPATLRNKVLQTLHRAHPGI
VRMKQLARSYVYWPGLDNDIEKLVKGCDSCARASKDPIKNTLFSWPMAKTPWERVHADFA
GPIDGKYYLLIIDAYSKWPEIHAMSSITSTATLKIMRRIFAQFGNPAVLVTDNGSQFTSA
QFKEFCVENGISHIRSPPYHPQSNGQVERFVDSFKRTLIKLEGEGSTEVAVQKFLQAYRS
TPCSASPNALTPAENFIGRKIRTVLDLLLPSCPDLTPQRNLKMERAFDRQNGARPREYDI
QDKVYVKINYNQSTATWLPGIITGKIGNTIYEVSVNGGTVKKHANQLRSRATPTPYPELV
EWLTLEDNEVDMSPPTLSPAPAPQVIPPAPLAPAVPLRRSARNPKPTVSFQLDPSKKSYQ
QK
Download sequence
Identical sequences G0N4L8
CBN25935 135651.CBN25935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]