SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN26335 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN26335
Domain Number 1 Region: 102-133,191-252
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-22
Family Voltage-gated potassium channels 0.0052
Further Details:      
 
Domain Number 2 Region: 267-349
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-18
Family Voltage-gated potassium channels 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN26335
Sequence length 367
Comment (Caenorhabditis brenneri)
Sequence
MHPRGKFLAGHLSAFYIAPATALISRNHNDWAHLQLLRKTTSCSSADAAGGGGGGGAGGG
NMNQIHFGTASARRRNAMILENNSGDGEEDASPKEGFLANLRLALFHLVLIFATVAYIIA
GAYLFTKIEHQAELDRYQSYHAIYRNFVDNLYQSSNRSVLDVENLIDTFTSINFRAFKDG
LKPNDFLFPQETSRWSMISAIFFTTTVLTSIGYGNLIPISTGGKIFCVGYAIFGIPLTLV
TIADLAKFVADMLIMDPTEDPKTGRQLLVLVFLLGYMTISACVYTILEPMWSFLDSFYFC
LVSLLTVGFGDLYPSGTVEYMLCSIVFIFIGLILTTLAVDVSGSVGIAKMHSIGRGFDAM
KMLNALR
Download sequence
Identical sequences G0NEC3
CBN26335 135651.CBN26335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]