SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000000740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000000740
Domain Number 1 Region: 1047-1219
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.88e-47
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.013
Further Details:      
 
Domain Number 2 Region: 437-498,564-661
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.54e-40
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.047
Further Details:      
 
Domain Number 3 Region: 903-1043
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.78e-36
Family Poly(A) polymerase, PAP, N-terminal domain 0.023
Further Details:      
 
Domain Number 4 Region: 280-469
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 9e-27
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.05
Further Details:      
 
Domain Number 5 Region: 1240-1267
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000541
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Domain Number 6 Region: 1287-1318
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000994
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000000740
Domain Number - Region: 863-887
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000314
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000000740
Sequence length 1596
Comment (Monodelphis domestica)
Sequence
MEESTSSKNGNHEPRKTARVVCEESKAIRATNNQNLKARNDRVIRDIGRSSPSGNSNKKN
KQNDVCTEKIDLKSCKVNTSSVSGTKDLGSVLQDQSHCKAKKSPGPLATIESGKPRAQQV
EENVPSSPIPEKDVNKETLLAVQKGKSALENAPGTPKLKMCTDNTSDSGNSISGTEDKSD
DLSNFKLKNSAEPTKDPPSELDYLENATTIDESMLTPEQKLGLKQAEERLERDYIFRLEK
RSPEYTNCRYLCKLCLVHIENIQGAHKHIKEKRHKKNITEKQEENELRSLPPPSPAQLAA
LSSTLMQAAKEQGISDNDFGFRQDIVTEMEKVIQLRLPDCSLRLYGSSMTRFAFKSSDVN
IDVKFPSTMSHPDVLIQVLDILKNCALYSEVESDFHAKVPVVFCKDVKSGLICKVSAGND
VACLTTDLLAALGKLEPVLTPLVLAFRYWARLCHIDCQAEGGIPSYSFALMVMFFLQQRK
PPLLPSYLGSWIEGFDSKRVDEHQLKGIEDEKFVKWEYKPLPSGPGKNSGTSENKAKADQ
RSGTKKATSSETDPQSGAAKERHGKSPLALEIPNQVSLGQLWLELLKFYTLEFALEEYVI
SVRVQELLTRENKNWPKRRIAIEDPFALKRNVARSLNSQMVFEYILERFRTAYKYFACPQ
SKDGNKSKVDSRKKERGKMSNKRPAKSGDVGTSCGPLQGENVEKINPGSRSGAHVCQSDD
CNETECTSQRCRKDVGRLVKKLDATDSSHGENDGCEAEPKPLEEQHDLEPSEICSKDELS
HQCNCHEHRSPDPDAINELEGTHCRPDLETKCSQTTPCTDIDTSATSPHCQGLAEASDLQ
EEDQLCPPEMHYVFDKFILTSGKPPTIVCSICKRDGHSKNDCPDDFKKIDLKPLPPMTYR
FRDILDLVCKKCFDELSPPFSEQQSREQILASLERFIQKEYNEKARLCLFGSSKNGFGFR
DSDLDICMTLDGHENAEKLNCKEIIEGLAKILKRHPGLKNILPITTAKVPIVKFEHRRSG
LEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYIL
MVLYFLQQRDPPVIPVLQEIFDGKQIPQRMVDGWNAFFFDDMEELKKRLPSLGQNTETLG
ELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRK
MTNFIMKAFINGRKLFGTPFYPLVGREAEYFFDSKALTDGELAPNDRCCRVCGKIGHYMK
DCPKRRSALLFRLKKKENEKEDEKEMKDEDRELREKRCFICGDVGHVRRECPEYKQARQR
NNGLAGAQLVRTLVSAQAVAGSVQQQVDRPLRTRQSSECSDSQPSSYSPQPPPFPQNSSQ
PASLAQTTPQPIAQPKHGPPQAAQPPHQVQLPLFNFPQSPPGQYSALHNLGLLQVHPPHP
IPLPGATWPIHGPVIHSAPGNPTHPAGVPLNDPSIIFAQPAARPPLGIPTSHEGHWHGPV
AANSLVNNGAVGNSDQGFQGQFAKLTPPIPWDHGAPAHFPILQASWPYGGVPQNFLQQGN
ASFQPNKAFYPPAIRRPLAHRCSHVPRHPPRGNGLK
Download sequence
Identical sequences F6TAS9
ENSMODP00000000740 ENSMODP00000000740 13616.ENSMODP00000000740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]