SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000001319 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000001319
Domain Number 1 Region: 183-289
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-19
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 2 Region: 9-36,79-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.94e-19
Family Voltage-gated potassium channels 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000001319
Sequence length 399
Comment (Monodelphis domestica)
Sequence
SHLNEDTGRFVLLAALIGLYLVAGATVFSALESPSEAAARERWSATLRNFSAAHGVGEEE
LLSFLRDYEAALAAGIRADALRPRWDFTGAFYFVGTVVSTIGFGMTTPSTVAGKAFLIAY
GLFGCAGTILFFNLFLERIISLLAFIMRACHERQLRRSGLLPPTFRRGSALSEADSLVGW
KPSVYHVMLILGIFAVILSCCASAMYTSVEGWDYMDSLYYCFVTFSTIGFGDLVSSQQEA
YQNQGLYRLGNFLFILMGVCCIYSLFNVISIIIKQVLNWMLKKLSCQCCTRCRKPSTRLG
RRNAITPGSRFRRHLTSMEADGHYDSDAEGRRLSGEMISMRDLIASNKVSLALLQKQLSE
TANGYPRNVCVNTRQNGFSGGVGALGIMNNRLAETSDSR
Download sequence
Identical sequences F7DPG9
13616.ENSMODP00000001319 ENSMODP00000001319 ENSMODP00000001319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]