SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000003556 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000003556
Domain Number 1 Region: 11-39,84-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-21
Family Voltage-gated potassium channels 0.0052
Further Details:      
 
Domain Number 2 Region: 187-292
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-18
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000003556
Sequence length 400
Comment (Monodelphis domestica)
Sequence
WSAGHLNQDNARFLLLAALIVLYMVCGAAVFSAIERAQECRAKEQWEEKLLNFSLNHNLS
LDEIRGFLREYEEATAAGIRIGDSRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKVFL
IFYGLIGCAGTILFFNLFLERLITVIAYIMKSCHERQLRKKGILQSDNQRSSGTSEADSM
VGWKPSVYYVMLILCMASLIISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQ
NAQYESQGLYRFGNFIFILMGVCCIYSLFNVISILIKQSVNWILKKMECQCCQCQRKALL
LRRNVVTPSNVRSGQEISIETDGVIESETDGRRLSGEMISMKDFLASNKVSLAILQKQLS
ETANGCPRQASMSARHKGFSGGVGALAIMNNRLAETSGDR
Download sequence
Identical sequences 13616.ENSMODP00000003556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]