SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000004327 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000004327
Domain Number 1 Region: 248-309,373-466
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2e-34
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.06
Further Details:      
 
Domain Number 2 Region: 94-281
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.78e-26
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.066
Further Details:      
 
Domain Number 3 Region: 691-763
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000107
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.055
Further Details:      
 
Domain Number 4 Region: 650-675
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000162
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000004327
Domain Number - Region: 54-90
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000105
Family Classic zinc finger, C2H2 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000004327
Sequence length 767
Comment (Monodelphis domestica)
Sequence
KSRKARKEEHDQEEDLDGPVIDESVLSVKELLGLRQAEERLKRDCIDRLRKRSRNYPTAK
YICKLCDVLVESIASAHKHIKEKRHKKNIKEKHEEQLLTTLPPPTPSQIKAIGVAIDKVV
EEFGLNNEDLEQRLEIKQTMEKLFHQKLPDCSLRLYGSSYSRFGFKNSDLNIDVQFPVTM
TQPDVLLLIQENLKNSESFIDVDADFHARVPVVVCREKQSGLICKVSAGNENACLTTNHL
AALGKLEPKLVPLVIAFRYWAKLCCTDHPDEGGLPPYVFALMAIFFLQQRKEPVLPVYLG
SWIEGFSLNKLVNFNLKEVENDLVVWEQTTATRDDESSKETSFKRGKPNDDYSWFKKKKG
LVQKEMKNKRQNVPLAFGLENQCSAPVGQLWVELLRFYALEFNLSDFVISIRAKEAISRE
AKDWPKRRIAVEDPYSVKRNVARTLNSQLVYEYILHCLRATYKYFAIPHKKTTKTTPKKP
LNTNIDASETSKHLEDDVKPDPEVQVINDKIMIIGDYDDSENGELLAHTNDHDMENDSIS
DLESFQNITITERDDFVTVDDKADMDEESTDELEDSNKYRDEDVLSEEDGLALPVKYEDL
KELSKNVDEPLLMELNEKQPLKEENAFEEDSTVDHLDLFYEFSKPVFTKGKPPTVVCSLC
KREGHLKKDCPEDFKKIELDPLPQLTTRFSNILDQVCIQCYSKLSTFLTMGVEFFNKSLI
LLALEQNFESLKKCTKLSLFGSSKNGFGFKQSDLDICMTIDGLETAE
Download sequence
Identical sequences 13616.ENSMODP00000004327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]