SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000005810 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000005810
Domain Number 1 Region: 157-392
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.97e-68
Family Tandem AAA-ATPase domain 0.0000468
Further Details:      
 
Domain Number 2 Region: 332-559
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.91e-53
Family Tandem AAA-ATPase domain 0.00098
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000005810
Domain Number - Region: 571-596
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000175
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000005810
Sequence length 615
Comment (Monodelphis domestica)
Sequence
MTCHSTQRSREEDDDPAGGLSEDEDYIPYVPVKQRKQQMLQKLLQMRRKGATEEEQKDSG
SEPRGDEDDIPLGPQSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESVAEGRALM
SVKEMAKGITYDDPIKTSWKAPRYVLSMSEARHDRVRKKYHILVEGEGIPPPLKSFKEMK
FPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQE
KRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPPLRCALCIGGMSVKEQM
ETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKG
QRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAKMVYLLEC
LQKTPPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFRDGKKDVLV
ATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMD
LKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCTFCGGLGHRITDCPKLEAMQTKQVS
NIGRKDYLAHSSMDF
Download sequence
Identical sequences 13616.ENSMODP00000005810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]