SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000006278 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000006278
Domain Number 1 Region: 368-492
Classification Level Classification E-value
Superfamily PX domain 3.05e-16
Family PX domain 0.0062
Further Details:      
 
Domain Number 2 Region: 1140-1168
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000297
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000006278
Sequence length 1198
Comment (Monodelphis domestica)
Sequence
RMLKMKLPLKQTHPKEQQQQLEAEEQEAAAADGRMGVKDPLHRRDCHLPLHPVVRPPLPP
TPLGPGGRCLRERPGPLRGLLLPGPPVAGGAAAVAAAAGEGMSLQGGCGPASLLRDQERV
YEWFGLVLGSAQRLEFMCGLLDLCNPLELRFLGSCLEDLARKDYHYLRDSEAKANGLTDP
GQLGDFRDPAVRSRLIVYLALLGSENREAAGRLHRLLPPVDSVLKSFSSVVACGPNSRPT
RSDPEPSEEKADKSEERGPEGNGVAPRADGLGFGAQEELLLLFTMASLHPAFSFHQRVTL
REHLERLRTALRGDQEDGEEQCNFTALRAQNDTSHGDYIRNNETSLMEQSPILHDGLTMA
SHRSQREAVHIEKIILKGVQRKRADKHWEYTFKVNWSDLSVTTVTKTHQELQEFLLKLPK
ELSSETFDKTILRALNQGSQKREERRHPDLEPILRQLFSASSQAFLQSQKVHNFFQSISS
ESLHSLSNLQSSLKASKIPEHLKEDSSEASSQEEEVLQHTTIHKKHTGKGPIMNTVGTSC
SSLDGLALQHSEQNGMVVDWRKKGCVLQHPEHCTLVDQHAADKWSLSSLSKKKGKPQIEK
EKIKKTDSRLNSRTNGVSVSTPQHVHGGTVKDPNLDIGSGHDTCGETSSESYSSPSSPRH
DGRESFESEEEKDRDTDSNSEDSGNPTTTRFTGYGTVNPSTVTVKPPAQISSLGNENGNI
SEDPLNPSKYQHISFMPALHCVMHNGAQKSEVVVPPKTAEGKAMGMLVTSPVAISAIRES
ANSTPVGILGPKVASGEPDKRLELLASPLPVPSPFLPHTVQPGSPALHLAIHRLKMPSPQ
GPSESCAVSVPQQPNGNLSIGSPNTAFIPVHNPGSFPGSPVATTDPLTKGASQVVGLNQM
VPQVEGNPGTIPQPPNVKVVLPSAGLSAAAQPPASYALPGSPLSAGTLPAQTANGLGTAA
TSTQSASPGVGQVQSSIPPAVPTHTPGPTPSPSPALTHSTAQSDSTSYISAVGNSNANGT
LLPPQQVGSGPCGSCGRRCSCGTNGNLQINSYFYPNPMPGPMYRVPSFFTLPSLCNGSYL
NQAHQSNGTQLPFFLPQTPYANGLMHDPVMGNQANYGMQQMAGFGRFYPVYPAPNVVANS
NGSGPKKNGNVSCYNCGVSGHYAQDCKQSSMEANQQGTYRLRYAPPPPPSNDTLDSAD
Download sequence
Identical sequences 13616.ENSMODP00000006278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]