SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000006488 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  13616.ENSMODP00000006488
Domain Number - Region: 31-92
Classification Level Classification E-value
Superfamily PH domain-like 0.0713
Family SSRP1-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000006488
Sequence length 236
Comment (Monodelphis domestica)
Sequence
FRDLGFNGASYRSTCLLQPTSSVLVNATEWPPFVVTLDKVKLIHFERVQFHLKNFDIIVY
KDYSKKVTIFNAIPLVSLDPIKEWLKSCDLKYTEGVQSLNWTKIMKTMDDPEGFFEQGGW
SFLEPEGEGSDAEVGDSESEIEDETFNPLEDEYEEEEEDSDEDYSSEAEESDYSKESLGS
EEEKNGKDWDELEEETRKADLESRYEEKEQQSQSMSWKRKGSVHSSGHGSSCGSRH
Download sequence
Identical sequences F7GGV8
13616.ENSMODP00000006488 ENSMODP00000006488 ENSMODP00000006488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]