SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000007639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  13616.ENSMODP00000007639
Domain Number - Region: 252-282
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00392
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000007639
Sequence length 947
Comment (Monodelphis domestica)
Sequence
MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDTSKPNPNEVEFDNLYLDMNGIIH
PCTHPEDKPAPKNEDEMMVAIFEYIDRLFNIVRPRRLLYMAIDGVAPRAKMNQQRSRRFR
ASKEGMESTIEKQRVREEILSKGGFLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIAD
RLNNDPGWKNLTVILSDASAPGEGEHKIMDYIRRQRAQPNHDPNTHHCLCGADADLIMLG
LATHEPNFTIIREEFKPNKPKPCGLCNQLGHEVKDCQGLPREKQGEHDQFEESLPASEGE
FIYIRLNVLREYLERELTMASLPFTFDIERSIDDWVFMCFFVGNDFLPHLPSLEIREGAI
DRLVNIYKNVVHKTGGYLTESGYVNLQRVQMIMLAVGEVEDSIFKKRKDDEESFKRRQKE
KRKRMKRDQPAFVPSGILTPQALGTRNSHGSQVASNPRQAAFEMRMHNNSSPLTSPNTSF
TSDGSPSPGGGIKRKAEDSDSEPEPEDNVRLWESGWKQRYYKNKFDVDAADDKFRRKVVQ
SYVEGLCWVLRYYYQGCASWKWYYPFHYAPFASDFDGIADMPSDFEKGTRPFKPLEQLMG
VFPAASGNFLPPSWRKLMSDPESSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRA
ALEEVYPDLTPDETRRNSLGGDVMFVGKHHPLCDFLSELYKTGSTEAVDLPPELCHGIQG
KLTLHKEAILPDQIVYSPVPVLRDLTQNTAISINFKDPQFAEDYIFKATVLPGARKPATV
LKPGDWEKSSNGRQWRPQLGFNRDRRPVHLDQSAFRTLGHVMPRGPGGGPYSNAAPPGNY
QGNLYRPMIRGQTQIPKLMSNMRPHDSWRGPTPLFHQPRFDRAAAEPLLPWNRMLQSQNA
AFQQNQYQLLGGPGGYPPRRDDRGGRQGYGPGRNYPLPPPSGRYNWN
Download sequence
Identical sequences F7BS67
13616.ENSMODP00000007639 ENSMODP00000007639 XP_001373979.1.35504 ENSMODP00000007639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]