SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000009338 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000009338
Domain Number 1 Region: 499-527,566-624
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000471
Family Anti-sigma factor antagonist SpoIIaa 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000009338
Sequence length 656
Comment (Monodelphis domestica)
Sequence
MTEVKRKKNSVVWRKINSFHCADIKQWCRRRLPILEWAPRYNLKENLIPDTVSGIMLAVQ
QVTHGLAFAILSSVHPVFGLYGSLFPVIIYAIFGMGRHVATGTFALTSLISANAVERLVP
QASQNFTTYSNSGVLGLSEFEMQRIGVATAVTFLGGIIQVAMFVLHLGSATFLLTEPVIS
AMTTGAATHVVTSQVKFLLGLKMPYISGPLGFFYIYAYVFENIKSVQLEALLLSLLSIVV
LVLVKELNEQFKSKIKVVLPVDLVLIIAASFACYFANMEYTYGLDVVGRIPYGIPSPRAP
PMNILSKVVIEAFGVALVGYVVSLALAQGSAKKFKYAVDDNQEFLAHGLSNVIASFFFCI
PNAAATGRTAGLYSTGSKTQVASLISCILVLIVIYTVAPLLYWLPMCVLASTIVVGLKGM
LIQFRDLKKYWNVDKIDWSIWVSTYIFTVCFAANVGLLFGVVCTIAVVIVRFPRAKTLSL
KNMKELQYRVKTEVEGENSQQVKMISINNPLIFLNAKKFHADLMNTIQKDNANNQSPDDI
NKCEQNTLLNSTFNGTCNGETPQPYPNEKCSVILDCTGVTFFDYTGVSTLVQAYTDCKSQ
NIDFLLANCTASLKKAVQYCGHLEPDKHIFFESVSAAIGAIHLNKNLSKFSDHSEV
Download sequence
Identical sequences F7GJR3
XP_001379265.1.35504 ENSMODP00000009338 13616.ENSMODP00000009338 ENSMODP00000009338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]