SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000010393 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000010393
Domain Number 1 Region: 135-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000226
Family Retrovirus zinc finger-like domains 0.001
Further Details:      
 
Domain Number 2 Region: 92-134
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000274
Family Retrovirus zinc finger-like domains 0.00097
Further Details:      
 
Domain Number 3 Region: 52-91
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000137
Family Retrovirus zinc finger-like domains 0.0012
Further Details:      
 
Domain Number 4 Region: 2-27
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000366
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000010393
Sequence length 177
Comment (Monodelphis domestica)
Sequence
MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSARGFQFVSSSLPDICYRCGES
GHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCY
SCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA
Download sequence
Identical sequences F7EJM5 G3WXP1
ENSSHAP00000020196 ENSMEUP00000010655 ENSMODP00000010393 ENSMODP00000039817 13616.ENSMODP00000010393 XP_001378413.2.35504 XP_003762539.1.9362 XP_020836868.1.61212 ENSSHAP00000020196 ENSMODP00000010393 ENSMEUP00000010655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]