SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000010787 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000010787
Domain Number 1 Region: 9-97
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.01e-23
Family Canonical RBD 0.002
Further Details:      
 
Domain Number 2 Region: 98-126
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000262
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000010787
Sequence length 235
Comment (Monodelphis domestica)
Sequence
MSCYGRYGGETKVYVGNLETGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVQGLDGKVICGSRVRVELSTGLPRRSRYDRPPARCPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRPRSASLRRSRSASIQSRS
GSLKRSRSSRSRSRSRSRSLSRPRSSQSKSRSPSPKRSHSPSGSPRRSASPERMD
Download sequence
Identical sequences F6PFZ3
ENSMODP00000010787 ENSMODP00000010787 13616.ENSMODP00000010787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]