SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000011084 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000011084
Domain Number 1 Region: 7-99
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.76e-30
Family Canonical RBD 0.0024
Further Details:      
 
Domain Number 2 Region: 95-123
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000715
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000011084
Sequence length 194
Comment (Monodelphis domestica)
Sequence
MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLD
KESAQNCSRALNNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSRCYECGETGHLSYAC
PKNVLGEQVEESEDEGEDPALDSLSQAIAFQQAKIEEDQQRWKPSASEPSTSDDSRRPRI
KKSAYFSDEEELSD
Download sequence
Identical sequences 13616.ENSMODP00000011084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]