SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000011093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000011093
Domain Number 1 Region: 407-521,641-787
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.19e-62
Family Phosphate binding protein-like 0.00000000215
Further Details:      
 
Domain Number 2 Region: 20-388
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.41e-56
Family L-arabinose binding protein-like 0.0069
Further Details:      
 
Domain Number 3 Region: 537-640
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000022
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000011093
Sequence length 902
Comment (Monodelphis domestica)
Sequence
MQCIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERKTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYDWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLGKKKDRLVVVDCESERLNAILGQIIKMEKNGIGYHYILANLGFMDMDL
AKFKESGANVTGFQLVNYTDTIPAKILQQWKNNDVRDHTRVDWKKPKYTSALTYDGVRVM
AEAFQSLRKQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDPATSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRMRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTATLPRNSGAGGSGENGRVVSHDFPKSMQTIPCMSHSSGMPLGAT
GL
Download sequence
Identical sequences XP_001379365.1.35504 13616.ENSMODP00000011093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]