SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000013632 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000013632
Domain Number 1 Region: 51-192
Classification Level Classification E-value
Superfamily EF-hand 4.33e-31
Family Calmodulin-like 0.00000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000013632
Sequence length 194
Comment (Monodelphis domestica)
Sequence
MPPKKPEPKKEAAKAALAPAPAPAPAPAPEAPKEPAFDPKSVKVRCIPFSAEFKEAFSLF
DRTPAGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNAKMLDFETFLPILQHI
SRNKDQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMSESEVEQLMAGQEDANG
CINYEAFVKHIMSG
Download sequence
Identical sequences 13616.ENSMODP00000013632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]