SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000014729 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  13616.ENSMODP00000014729
Domain Number - Region: 92-120
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00238
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000014729
Sequence length 158
Comment (Monodelphis domestica)
Sequence
LGPDAAAGPERRGGRLEQQRLQEQKPRWRDAQQRHQLQHLESFYEKPPPGLIKEDETKPE
DCIPDVPGNEHAREFLAHAPTKGLWMPLGKEVKVMQCWRCKRYGHRTGDKECPFFIKGNQ
KLEQFRVAHEDPIYDIIRENKRHEKDVRIQQLKKLLED
Download sequence
Identical sequences F7CWF9
13616.ENSMODP00000014729 ENSMODP00000014729 ENSMODP00000014729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]