SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000015906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000015906
Domain Number 1 Region: 87-128
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000244
Family Retrovirus zinc finger-like domains 0.00097
Further Details:      
 
Domain Number 2 Region: 48-84
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000438
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 
Domain Number 3 Region: 137-166
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000301
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000015906
Domain Number - Region: 2-29
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000707
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000015906
Sequence length 170
Comment (Monodelphis domestica)
Sequence
MSSNECFKCRCSDHWAQECPTGGGHGQGMWSHGRGFQFVSSSLPDIRYRCGESGHLAKDC
DLQEDEAYYNCGRGGHIAKDCKEAREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGH
IQKDCTKVKWYRWYTNNTYKPNERKPGPMQCFLCDHIGHLYRDCRFRNQV
Download sequence
Identical sequences F6TYE0
ENSMODP00000015906 ENSMODP00000015906 13616.ENSMODP00000015906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]